Protein Description: proteolipid protein 1
Gene Name: PLP1
Alternative Gene Name: GPM6C, PLP, SPG2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000031425: 100%, ENSRNOG00000002419: 100%
Entrez Gene ID: 5354
Uniprot ID: P60201
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: PLP1
Alternative Gene Name: GPM6C, PLP, SPG2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000031425: 100%, ENSRNOG00000002419: 100%
Entrez Gene ID: 5354
Uniprot ID: P60201
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Gene Sequence | LLLAEGFYTTGAVRQIFGDYKTTICGKGLSATVTGGQKGRGSRGQHQAHSLERVCHCLGKWLGHPDKFVGI |
Documents & Links for Anti PLP1 pAb (ATL-HPA004128 w/enhanced validation) | |
Datasheet | Anti PLP1 pAb (ATL-HPA004128 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti PLP1 pAb (ATL-HPA004128 w/enhanced validation) at Atlas |
Documents & Links for Anti PLP1 pAb (ATL-HPA004128 w/enhanced validation) | |
Datasheet | Anti PLP1 pAb (ATL-HPA004128 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti PLP1 pAb (ATL-HPA004128 w/enhanced validation) |
Citations for Anti PLP1 pAb (ATL-HPA004128 w/enhanced validation) – 3 Found |
Nishino, Satoshi; Fujiki, Yoko; Sato, Takanari; Kato, Yukino; Shirai, Remina; Oizumi, Hiroaki; Yamamoto, Masahiro; Ohbuchi, Katsuya; Miyamoto, Yuki; Mizoguchi, Kazushige; Yamauchi, Junji. Hesperetin, a Citrus Flavonoid, Ameliorates Inflammatory Cytokine-Mediated Inhibition of Oligodendroglial Cell Morphological Differentiation. Neurology International. 2022;14(2):471-487. PubMed |
Matsumoto, Naoto; Miyamoto, Yuki; Hattori, Kohei; Ito, Akihiro; Harada, Hironori; Oizumi, Hiroaki; Ohbuchi, Katsuya; Mizoguchi, Kazushige; Yamauchi, Junji. PP1C and PP2A are p70S6K Phosphatases Whose Inhibition Ameliorates HLD12-Associated Inhibition of Oligodendroglial Cell Morphological Differentiation. Biomedicines. 2020;8(4) PubMed |
Hattori, Kohei; Tago, Kenji; Memezawa, Shiori; Ochiai, Arisa; Sawaguchi, Sui; Kato, Yukino; Sato, Takanari; Tomizuka, Kazuma; Ooizumi, Hiroaki; Ohbuchi, Katsuya; Mizoguchi, Kazushige; Miyamoto, Yuki; Yamauchi, Junji. The Infantile Leukoencephalopathy-Associated Mutation of C11ORF73/HIKESHI Proteins Generates de novo Interactive Activity with Filamin A, Inhibiting Oligodendroglial Cell Morphological Differentiation. Medicines (Basel, Switzerland). 2021;8(2) PubMed |