Anti PLN pAb (ATL-HPA026900 w/enhanced validation)

Atlas

Catalog No: ATL-HPA026900-25

• 
• 

Protein Description: phospholamban
Gene Name: PLN
Alternative Gene Name: CMD1P, PLB
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000038583: 97%, ENSRNOG00000000413: 97%
Entrez Gene ID: 5350
Uniprot ID: P26678
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: EKVQYLTRSAIRRASTIEMPQQARQKLQNL
• Gene Sequence: EKVQYLTRSAIRRASTIEMPQQARQKLQNL
• Gene ID - Mouse: ENSMUSG00000038583
• Gene ID - Rat: ENSRNOG00000000413
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti PLN pAb (ATL-HPA026900 w/enhanced validation) – 2 Found

Wu, Dawei; Schieren, Ira; Qian, Yingzhi; Zhang, Chaolin; Jessell, Thomas M; de Nooij, Joriene C. A Role for Sensory end Organ-Derived Signals in Regulating Muscle Spindle Proprioceptor Phenotype. The Journal Of Neuroscience : The Official Journal Of The Society For Neuroscience. 2019;39(22):4252-4267. 

Li, Zhidong; Guo, Jia; Bian, Yunfei; Zhang, Mingsheng. Intermedin protects thapsigargin‑induced endoplasmic reticulum stress in cardiomyocytes by modulating protein kinase A and sarco/endoplasmic reticulum Ca(2+)‑ATPase. Molecular Medicine Reports. 2021;23(2)