Anti PLK5 pAb (ATL-HPA035024 w/enhanced validation)

Atlas Antibodies

Catalog No: ATL-HPA035024-25

• 

Product Description

Protein Description: polo-like kinase 5
Gene Name: PLK5
Alternative Gene Name: PLK5P, SgK384ps
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000035486: 82%, ENSRNOG00000034102: 79%
Entrez Gene ID: 126520
Uniprot ID: Q496M5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: YTVLTGTPPFMASPLSEMYQNIREGHYPEPAHLSANARRLIVHLLAPNPAERPSLDHLLQDDFFTQ
• Gene Sequence: YTVLTGTPPFMASPLSEMYQNIREGHYPEPAHLSANARRLIVHLLAPNPAERPSLDHLLQDDFFTQ
• Gene ID - Mouse: ENSMUSG00000035486
• Gene ID - Rat: ENSRNOG00000034102
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.