Protein Description: perilipin 5
Gene Name: PLIN5
Alternative Gene Name: LSDA5, LSDP5, MLDP, OXPAT
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000011305: 59%, ENSRNOG00000047860: 62%
Entrez Gene ID: 440503
Uniprot ID: Q00G26
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: PLIN5
Alternative Gene Name: LSDA5, LSDP5, MLDP, OXPAT
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000011305: 59%, ENSRNOG00000047860: 62%
Entrez Gene ID: 440503
Uniprot ID: Q00G26
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | GPFAPILVERPEPLPDLADLVDEVIGGPDPRWAHLDWPAQQRAWEAEHRDGSGNGDGDRMGVAGDICEQEPETPSCPVKHTLMPELD |
| Documents & Links for Anti PLIN5 pAb (ATL-HPA077050) | |
| Datasheet | Anti PLIN5 pAb (ATL-HPA077050) Datasheet (External Link) |
| Vendor Page | Anti PLIN5 pAb (ATL-HPA077050) at Atlas |
| Documents & Links for Anti PLIN5 pAb (ATL-HPA077050) | |
| Datasheet | Anti PLIN5 pAb (ATL-HPA077050) Datasheet (External Link) |
| Vendor Page | Anti PLIN5 pAb (ATL-HPA077050) |