Anti PLIN5 pAb (ATL-HPA077050)

Catalog No:
ATL-HPA077050-25
$447.00

Description

Product Description

Protein Description: perilipin 5
Gene Name: PLIN5
Alternative Gene Name: LSDA5, LSDP5, MLDP, OXPAT
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000011305: 59%, ENSRNOG00000047860: 62%
Entrez Gene ID: 440503
Uniprot ID: Q00G26
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen GPFAPILVERPEPLPDLADLVDEVIGGPDPRWAHLDWPAQQRAWEAEHRDGSGNGDGDRMGVAGDICEQEPETPSCPVKHTLMPELD
Gene Sequence GPFAPILVERPEPLPDLADLVDEVIGGPDPRWAHLDWPAQQRAWEAEHRDGSGNGDGDRMGVAGDICEQEPETPSCPVKHTLMPELD
Gene ID - Mouse ENSMUSG00000011305
Gene ID - Rat ENSRNOG00000047860
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links

Documents & Links for Anti PLIN5 pAb (ATL-HPA077050)
Datasheet Anti PLIN5 pAb (ATL-HPA077050) Datasheet (External Link)
Vendor Page Anti PLIN5 pAb (ATL-HPA077050) at Atlas Antibodies

Documents & Links for Anti PLIN5 pAb (ATL-HPA077050)
Datasheet Anti PLIN5 pAb (ATL-HPA077050) Datasheet (External Link)
Vendor Page Anti PLIN5 pAb (ATL-HPA077050)

Product Description

Protein Description: perilipin 5
Gene Name: PLIN5
Alternative Gene Name: LSDA5, LSDP5, MLDP, OXPAT
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000011305: 59%, ENSRNOG00000047860: 62%
Entrez Gene ID: 440503
Uniprot ID: Q00G26
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen GPFAPILVERPEPLPDLADLVDEVIGGPDPRWAHLDWPAQQRAWEAEHRDGSGNGDGDRMGVAGDICEQEPETPSCPVKHTLMPELD
Gene Sequence GPFAPILVERPEPLPDLADLVDEVIGGPDPRWAHLDWPAQQRAWEAEHRDGSGNGDGDRMGVAGDICEQEPETPSCPVKHTLMPELD
Gene ID - Mouse ENSMUSG00000011305
Gene ID - Rat ENSRNOG00000047860
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links

Documents & Links for Anti PLIN5 pAb (ATL-HPA077050)
Datasheet Anti PLIN5 pAb (ATL-HPA077050) Datasheet (External Link)
Vendor Page Anti PLIN5 pAb (ATL-HPA077050) at Atlas Antibodies

Documents & Links for Anti PLIN5 pAb (ATL-HPA077050)
Datasheet Anti PLIN5 pAb (ATL-HPA077050) Datasheet (External Link)
Vendor Page Anti PLIN5 pAb (ATL-HPA077050)