Anti PLEKHH2 pAb (ATL-HPA077225)

Catalog No:
ATL-HPA077225-25
$447.00
Protein Description: pleckstrin homology domain containing, family H (with MyTH4 domain) member 2
Gene Name: PLEKHH2
Alternative Gene Name: KIAA2028, PLEKHH1L
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000040852: 74%, ENSRNOG00000005124: 77%
Entrez Gene ID: 130271
Uniprot ID: Q8IVE3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Gene Sequence STLSSHTSEEGVQCSRMGSEMYLTASDDSSSIFEEETFGIKRPEHKKLYSWQQEAQWKALNSPLGKGNSE
Gene ID - Mouse ENSMUSG00000040852
Gene ID - Rat ENSMUSG00000040852
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Documents & Links for Anti PLEKHH2 pAb (ATL-HPA077225)
Datasheet Anti PLEKHH2 pAb (ATL-HPA077225) Datasheet (External Link)
Vendor Page Anti PLEKHH2 pAb (ATL-HPA077225) at Atlas

Documents & Links for Anti PLEKHH2 pAb (ATL-HPA077225)
Datasheet Anti PLEKHH2 pAb (ATL-HPA077225) Datasheet (External Link)
Vendor Page Anti PLEKHH2 pAb (ATL-HPA077225)