Protein Description: pleckstrin homology domain containing, family H (with MyTH4 domain) member 2
Gene Name: PLEKHH2
Alternative Gene Name: KIAA2028, PLEKHH1L
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000040852: 74%, ENSRNOG00000005124: 77%
Entrez Gene ID: 130271
Uniprot ID: Q8IVE3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: PLEKHH2
Alternative Gene Name: KIAA2028, PLEKHH1L
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000040852: 74%, ENSRNOG00000005124: 77%
Entrez Gene ID: 130271
Uniprot ID: Q8IVE3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | STLSSHTSEEGVQCSRMGSEMYLTASDDSSSIFEEETFGIKRPEHKKLYSWQQEAQWKALNSPLGKGNSE |
| Documents & Links for Anti PLEKHH2 pAb (ATL-HPA077225) | |
| Datasheet | Anti PLEKHH2 pAb (ATL-HPA077225) Datasheet (External Link) |
| Vendor Page | Anti PLEKHH2 pAb (ATL-HPA077225) at Atlas |
| Documents & Links for Anti PLEKHH2 pAb (ATL-HPA077225) | |
| Datasheet | Anti PLEKHH2 pAb (ATL-HPA077225) Datasheet (External Link) |
| Vendor Page | Anti PLEKHH2 pAb (ATL-HPA077225) |