Description
Product Description
Protein Description: pleckstrin homology domain containing, family G (with RhoGef domain) member 6
Gene Name: PLEKHG6
Alternative Gene Name: FLJ10665, MYOGEF
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000038167: 77%, ENSRNOG00000019528: 73%
Entrez Gene ID: 55200
Uniprot ID: Q3KR16
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: PLEKHG6
Alternative Gene Name: FLJ10665, MYOGEF
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000038167: 77%, ENSRNOG00000019528: 73%
Entrez Gene ID: 55200
Uniprot ID: Q3KR16
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications
| Product Specifications | |
| Application | ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | KAFGPPHEGPLQGLVASRIETYGGRHRASAQSTTGRLYPRGYPVLDPSRRRLQQYVPFARGSGQARGLSPMRLRDPEPEKR |
| Gene Sequence | KAFGPPHEGPLQGLVASRIETYGGRHRASAQSTTGRLYPRGYPVLDPSRRRLQQYVPFARGSGQARGLSPMRLRDPEPEKR |
| Gene ID - Mouse | ENSMUSG00000038167 |
| Gene ID - Rat | ENSRNOG00000019528 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links
| Documents & Links for Anti PLEKHG6 pAb (ATL-HPA058230) | |
| Datasheet | Anti PLEKHG6 pAb (ATL-HPA058230) Datasheet (External Link) |
| Vendor Page | Anti PLEKHG6 pAb (ATL-HPA058230) at Atlas Antibodies |
| Documents & Links for Anti PLEKHG6 pAb (ATL-HPA058230) | |
| Datasheet | Anti PLEKHG6 pAb (ATL-HPA058230) Datasheet (External Link) |
| Vendor Page | Anti PLEKHG6 pAb (ATL-HPA058230) |