Anti PLEKHG3 pAb (ATL-HPA074734 w/enhanced validation)

Atlas Antibodies

Catalog No: ATL-HPA074734-25

• 

Product Description

Protein Description: pleckstrin homology and RhoGEF domain containing G3
Gene Name: PLEKHG3
Alternative Gene Name: ARHGEF43, KIAA0599
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000052609: 69%, ENSRNOG00000006570: 60%
Entrez Gene ID: 26030
Uniprot ID: A1L390
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: SFESISSLPEVEPDPEAGSEQEVFSAVEGPSAEETPSDTESPEVLETQLDAHQGLLGMDPPGDMVDFVAA
• Gene Sequence: SFESISSLPEVEPDPEAGSEQEVFSAVEGPSAEETPSDTESPEVLETQLDAHQGLLGMDPPGDMVDFVAA
• Gene ID - Mouse: ENSMUSG00000052609
• Gene ID - Rat: ENSRNOG00000006570
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.