Protein Description: pleckstrin homology and RhoGEF domain containing G3
Gene Name: PLEKHG3
Alternative Gene Name: ARHGEF43, KIAA0599
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000052609: 69%, ENSRNOG00000006570: 60%
Entrez Gene ID: 26030
Uniprot ID: A1L390
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: PLEKHG3
Alternative Gene Name: ARHGEF43, KIAA0599
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000052609: 69%, ENSRNOG00000006570: 60%
Entrez Gene ID: 26030
Uniprot ID: A1L390
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Gene Sequence | SFESISSLPEVEPDPEAGSEQEVFSAVEGPSAEETPSDTESPEVLETQLDAHQGLLGMDPPGDMVDFVAA |
Documents & Links for Anti PLEKHG3 pAb (ATL-HPA074734 w/enhanced validation) | |
Datasheet | Anti PLEKHG3 pAb (ATL-HPA074734 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti PLEKHG3 pAb (ATL-HPA074734 w/enhanced validation) at Atlas |
Documents & Links for Anti PLEKHG3 pAb (ATL-HPA074734 w/enhanced validation) | |
Datasheet | Anti PLEKHG3 pAb (ATL-HPA074734 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti PLEKHG3 pAb (ATL-HPA074734 w/enhanced validation) |