Protein Description: pleckstrin homology and RhoGEF domain containing G3
Gene Name: PLEKHG3
Alternative Gene Name: ARHGEF43, KIAA0599
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000052609: 69%, ENSRNOG00000006570: 68%
Entrez Gene ID: 26030
Uniprot ID: A1L390
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: PLEKHG3
Alternative Gene Name: ARHGEF43, KIAA0599
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000052609: 69%, ENSRNOG00000006570: 68%
Entrez Gene ID: 26030
Uniprot ID: A1L390
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | PDGGETLYVTADLTLEDNRRVIVMEKGPLPSPTAGLEESSGQGPSSPVALLGQVQDFQQSAECQPKEEGSRDPADPSQQGR |
| Documents & Links for Anti PLEKHG3 pAb (ATL-HPA073702 w/enhanced validation) | |
| Datasheet | Anti PLEKHG3 pAb (ATL-HPA073702 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti PLEKHG3 pAb (ATL-HPA073702 w/enhanced validation) at Atlas |
| Documents & Links for Anti PLEKHG3 pAb (ATL-HPA073702 w/enhanced validation) | |
| Datasheet | Anti PLEKHG3 pAb (ATL-HPA073702 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti PLEKHG3 pAb (ATL-HPA073702 w/enhanced validation) |