Anti PLEKHG3 pAb (ATL-HPA073702 w/enhanced validation)

Catalog No:
ATL-HPA073702-25
$447.00

Description

Product Description

Protein Description: pleckstrin homology and RhoGEF domain containing G3
Gene Name: PLEKHG3
Alternative Gene Name: ARHGEF43, KIAA0599
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000052609: 69%, ENSRNOG00000006570: 68%
Entrez Gene ID: 26030
Uniprot ID: A1L390
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen PDGGETLYVTADLTLEDNRRVIVMEKGPLPSPTAGLEESSGQGPSSPVALLGQVQDFQQSAECQPKEEGSRDPADPSQQGR
Gene Sequence PDGGETLYVTADLTLEDNRRVIVMEKGPLPSPTAGLEESSGQGPSSPVALLGQVQDFQQSAECQPKEEGSRDPADPSQQGR
Gene ID - Mouse ENSMUSG00000052609
Gene ID - Rat ENSRNOG00000006570
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links


Documents & Links for Anti PLEKHG3 pAb (ATL-HPA073702 w/enhanced validation)
Datasheet Anti PLEKHG3 pAb (ATL-HPA073702 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti PLEKHG3 pAb (ATL-HPA073702 w/enhanced validation)

Product Description

Protein Description: pleckstrin homology and RhoGEF domain containing G3
Gene Name: PLEKHG3
Alternative Gene Name: ARHGEF43, KIAA0599
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000052609: 69%, ENSRNOG00000006570: 68%
Entrez Gene ID: 26030
Uniprot ID: A1L390
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen PDGGETLYVTADLTLEDNRRVIVMEKGPLPSPTAGLEESSGQGPSSPVALLGQVQDFQQSAECQPKEEGSRDPADPSQQGR
Gene Sequence PDGGETLYVTADLTLEDNRRVIVMEKGPLPSPTAGLEESSGQGPSSPVALLGQVQDFQQSAECQPKEEGSRDPADPSQQGR
Gene ID - Mouse ENSMUSG00000052609
Gene ID - Rat ENSRNOG00000006570
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links


Documents & Links for Anti PLEKHG3 pAb (ATL-HPA073702 w/enhanced validation)
Datasheet Anti PLEKHG3 pAb (ATL-HPA073702 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti PLEKHG3 pAb (ATL-HPA073702 w/enhanced validation)