Description
Product Description
Protein Description: pleckstrin homology domain containing, family G (with RhoGef domain) member 3
Gene Name: PLEKHG3
Alternative Gene Name: ARHGEF43, KIAA0599
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000052609: 69%, ENSRNOG00000006570: 68%
Entrez Gene ID: 26030
Uniprot ID: A1L390
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: PLEKHG3
Alternative Gene Name: ARHGEF43, KIAA0599
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000052609: 69%, ENSRNOG00000006570: 68%
Entrez Gene ID: 26030
Uniprot ID: A1L390
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | PDGGETLYVTADLTLEDNRRVIVMEKGPLPSPTAGLEESSGQGPSSPVALLGQVQDFQQSAECQPKEEGSRDPADPSQQGR |
Gene Sequence | PDGGETLYVTADLTLEDNRRVIVMEKGPLPSPTAGLEESSGQGPSSPVALLGQVQDFQQSAECQPKEEGSRDPADPSQQGR |
Gene ID - Mouse | ENSMUSG00000052609 |
Gene ID - Rat | ENSRNOG00000006570 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links
Documents & Links for Anti PLEKHG3 pAb (ATL-HPA065323) | |
Datasheet | Anti PLEKHG3 pAb (ATL-HPA065323) Datasheet (External Link) |
Vendor Page | Anti PLEKHG3 pAb (ATL-HPA065323) at Atlas Antibodies |
Documents & Links for Anti PLEKHG3 pAb (ATL-HPA065323) | |
Datasheet | Anti PLEKHG3 pAb (ATL-HPA065323) Datasheet (External Link) |
Vendor Page | Anti PLEKHG3 pAb (ATL-HPA065323) |