Protein Description: pleckstrin homology domain containing B2
Gene Name: PLEKHB2
Alternative Gene Name: EVT2, FLJ20783
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000026123: 95%, ENSRNOG00000014162: 94%
Entrez Gene ID: 55041
Uniprot ID: Q96CS7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: PLEKHB2
Alternative Gene Name: EVT2, FLJ20783
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000026123: 95%, ENSRNOG00000014162: 94%
Entrez Gene ID: 55041
Uniprot ID: Q96CS7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | WB, IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Gene Sequence | YGYGPYGGAYPPGTQVVYAANGQAYAVPYQYPYAGLYGQQPANQVIIRERYRDNDSDLALGM |
Documents & Links for Anti PLEKHB2 pAb (ATL-HPA075014) | |
Datasheet | Anti PLEKHB2 pAb (ATL-HPA075014) Datasheet (External Link) |
Vendor Page | Anti PLEKHB2 pAb (ATL-HPA075014) at Atlas |
Documents & Links for Anti PLEKHB2 pAb (ATL-HPA075014) | |
Datasheet | Anti PLEKHB2 pAb (ATL-HPA075014) Datasheet (External Link) |
Vendor Page | Anti PLEKHB2 pAb (ATL-HPA075014) |