Description
Product Description
Protein Description: pleckstrin homology domain containing, family A (phosphoinositide binding specific) member 1
Gene Name: PLEKHA1
Alternative Gene Name: TAPP1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000040268: 91%, ENSRNOG00000020497: 92%
Entrez Gene ID: 59338
Uniprot ID: Q9HB21
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: PLEKHA1
Alternative Gene Name: TAPP1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000040268: 91%, ENSRNOG00000020497: 92%
Entrez Gene ID: 59338
Uniprot ID: Q9HB21
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | ITVPKQSDSQPNSDNLSRHGECGKKQVSYRTDIVGGVPIITPTQKEEVNECGESIDRNNLKRSQSHLPYFTPKPPQ |
Gene Sequence | ITVPKQSDSQPNSDNLSRHGECGKKQVSYRTDIVGGVPIITPTQKEEVNECGESIDRNNLKRSQSHLPYFTPKPPQ |
Gene ID - Mouse | ENSMUSG00000040268 |
Gene ID - Rat | ENSRNOG00000020497 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links
Documents & Links for Anti PLEKHA1 pAb (ATL-HPA064795) | |
Datasheet | Anti PLEKHA1 pAb (ATL-HPA064795) Datasheet (External Link) |
Vendor Page | Anti PLEKHA1 pAb (ATL-HPA064795) at Atlas Antibodies |
Documents & Links for Anti PLEKHA1 pAb (ATL-HPA064795) | |
Datasheet | Anti PLEKHA1 pAb (ATL-HPA064795) Datasheet (External Link) |
Vendor Page | Anti PLEKHA1 pAb (ATL-HPA064795) |