Anti PLEKHA1 pAb (ATL-HPA064795)

Atlas Antibodies

Catalog No: ATL-HPA064795-25

• 

Product Description

Protein Description: pleckstrin homology domain containing, family A (phosphoinositide binding specific) member 1
Gene Name: PLEKHA1
Alternative Gene Name: TAPP1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000040268: 91%, ENSRNOG00000020497: 92%
Entrez Gene ID: 59338
Uniprot ID: Q9HB21
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: ITVPKQSDSQPNSDNLSRHGECGKKQVSYRTDIVGGVPIITPTQKEEVNECGESIDRNNLKRSQSHLPYFTPKPPQ
• Gene Sequence: ITVPKQSDSQPNSDNLSRHGECGKKQVSYRTDIVGGVPIITPTQKEEVNECGESIDRNNLKRSQSHLPYFTPKPPQ
• Gene ID - Mouse: ENSMUSG00000040268
• Gene ID - Rat: ENSRNOG00000020497
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.