Anti PLD3 pAb (ATL-HPA012800)

Atlas Antibodies

Catalog No: ATL-HPA012800-25

• 
• 

Product Description

Protein Description: phospholipase D family, member 3
Gene Name: PLD3
Alternative Gene Name: HU-K4
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000003363: 90%, ENSRNOG00000018390: 90%
Entrez Gene ID: 23646
Uniprot ID: Q8IV08
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: LDFPNASTGNPSTSQAWLGLLAGAHSSLDIASFYWTLTNNDTHTQEPSAQQGEEVLRQLQTLAPKGVNVRIAVSKPSGPQPQADLQALLQSGAQVRMVDMQKLTHGVLHTKFWVVDQTHFYLGSAN
• Gene Sequence: LDFPNASTGNPSTSQAWLGLLAGAHSSLDIASFYWTLTNNDTHTQEPSAQQGEEVLRQLQTLAPKGVNVRIAVSKPSGPQPQADLQALLQSGAQVRMVDMQKLTHGVLHTKFWVVDQTHFYLGSAN
• Gene ID - Mouse: ENSMUSG00000003363
• Gene ID - Rat: ENSRNOG00000018390
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations

Citations for Anti PLD3 pAb (ATL-HPA012800) – 5 Found

Mukadam, Aamir S; Breusegem, Sophia Y; Seaman, Matthew N J. Analysis of novel endosome-to-Golgi retrieval genes reveals a role for PLD3 in regulating endosomal protein sorting and amyloid precursor protein processing. Cellular And Molecular Life Sciences : Cmls. 2018;75(14):2613-2625. 

Tan, Mengshan; Li, Jieqiong; Ma, Fangchen; Zhang, Xing; Zhao, Qingfei; Cao, Xipeng. PLD3 Rare Variants Identified in Late-Onset Alzheimer's Disease Affect Amyloid-β Levels in Cellular Model. Frontiers In Neuroscience. 13( 30837833):116. 

Satoh, Jun-Ichi; Kino, Yoshihiro; Yamamoto, Yoji; Kawana, Natsuki; Ishida, Tsuyoshi; Saito, Yuko; Arima, Kunimasa. PLD3 is accumulated on neuritic plaques in Alzheimer's disease brains. Alzheimer's Research & Therapy. 6(9):70. 

Chapman, Thomas P; Corridoni, Daniele; Shiraishi, Seiji; Pandey, Sumeet; Aulicino, Anna; Wigfield, Simon; do Carmo Costa, Maria; Thézénas, Marie-Laëtitia; Paulson, Henry; Fischer, Roman; Kessler, Benedikt M; Simmons, Alison. Ataxin-3 Links NOD2 and TLR2 Mediated Innate Immune Sensing and Metabolism in Myeloid Cells. Frontiers In Immunology. 10( 31379806):1495. 

Yuan, Peng; Zhang, Mengyang; Tong, Lei; Morse, Thomas M; McDougal, Robert A; Ding, Hui; Chan, Diane; Cai, Yifei; Grutzendler, Jaime. PLD3 affects axonal spheroids and network defects in Alzheimer's disease. Nature. 2022;612(7939):328-337.