Anti PLCXD2 pAb (ATL-HPA055947)

Atlas Antibodies

Catalog No: ATL-HPA055947-25

• 
• 

Product Description

Protein Description: phosphatidylinositol-specific phospholipase C, X domain containing 2
Gene Name: PLCXD2
Alternative Gene Name: FLJ31579
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000087141: 94%, ENSRNOG00000042289: 95%
Entrez Gene ID: 257068
Uniprot ID: Q0VAA5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: DFNHFYAMDETHHKCLVLRIQEAFGNKLCPACSVESLTLRTLWEKNCQVLIFYHCPFYKQYPFLWPGKKIPAPWANTTS
• Gene Sequence: DFNHFYAMDETHHKCLVLRIQEAFGNKLCPACSVESLTLRTLWEKNCQVLIFYHCPFYKQYPFLWPGKKIPAPWANTTS
• Gene ID - Mouse: ENSMUSG00000087141
• Gene ID - Rat: ENSRNOG00000042289
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.