Anti PLCH2 pAb (ATL-HPA072705)

Catalog No:
ATL-HPA072705-25
$447.00

Description

Product Description

Protein Description: phospholipase C eta 2
Gene Name: PLCH2
Alternative Gene Name: KIAA0450, PLC-eta2, PLCeta2, PLCL4, RP3-395M20.1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000029055: 75%, ENSRNOG00000014226: 80%
Entrez Gene ID: 9651
Uniprot ID: O75038
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen AEEDVESGEDAGASRRNGRLVVGSFSRRKKKGSKLKKAASVEEGDEGQDSPGGQSRGATRQKKTMKLSR
Gene Sequence AEEDVESGEDAGASRRNGRLVVGSFSRRKKKGSKLKKAASVEEGDEGQDSPGGQSRGATRQKKTMKLSR
Gene ID - Mouse ENSMUSG00000029055
Gene ID - Rat ENSRNOG00000014226
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links

Documents & Links for Anti PLCH2 pAb (ATL-HPA072705)
Datasheet Anti PLCH2 pAb (ATL-HPA072705) Datasheet (External Link)
Vendor Page Anti PLCH2 pAb (ATL-HPA072705) at Atlas Antibodies

Documents & Links for Anti PLCH2 pAb (ATL-HPA072705)
Datasheet Anti PLCH2 pAb (ATL-HPA072705) Datasheet (External Link)
Vendor Page Anti PLCH2 pAb (ATL-HPA072705)

Product Description

Protein Description: phospholipase C eta 2
Gene Name: PLCH2
Alternative Gene Name: KIAA0450, PLC-eta2, PLCeta2, PLCL4, RP3-395M20.1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000029055: 75%, ENSRNOG00000014226: 80%
Entrez Gene ID: 9651
Uniprot ID: O75038
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen AEEDVESGEDAGASRRNGRLVVGSFSRRKKKGSKLKKAASVEEGDEGQDSPGGQSRGATRQKKTMKLSR
Gene Sequence AEEDVESGEDAGASRRNGRLVVGSFSRRKKKGSKLKKAASVEEGDEGQDSPGGQSRGATRQKKTMKLSR
Gene ID - Mouse ENSMUSG00000029055
Gene ID - Rat ENSRNOG00000014226
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links

Documents & Links for Anti PLCH2 pAb (ATL-HPA072705)
Datasheet Anti PLCH2 pAb (ATL-HPA072705) Datasheet (External Link)
Vendor Page Anti PLCH2 pAb (ATL-HPA072705) at Atlas Antibodies

Documents & Links for Anti PLCH2 pAb (ATL-HPA072705)
Datasheet Anti PLCH2 pAb (ATL-HPA072705) Datasheet (External Link)
Vendor Page Anti PLCH2 pAb (ATL-HPA072705)