Description
Product Description
Protein Description: phospholipase C eta 2
Gene Name: PLCH2
Alternative Gene Name: KIAA0450, PLC-eta2, PLCeta2, PLCL4, RP3-395M20.1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000029055: 75%, ENSRNOG00000014226: 80%
Entrez Gene ID: 9651
Uniprot ID: O75038
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: PLCH2
Alternative Gene Name: KIAA0450, PLC-eta2, PLCeta2, PLCL4, RP3-395M20.1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000029055: 75%, ENSRNOG00000014226: 80%
Entrez Gene ID: 9651
Uniprot ID: O75038
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | AEEDVESGEDAGASRRNGRLVVGSFSRRKKKGSKLKKAASVEEGDEGQDSPGGQSRGATRQKKTMKLSR |
Gene Sequence | AEEDVESGEDAGASRRNGRLVVGSFSRRKKKGSKLKKAASVEEGDEGQDSPGGQSRGATRQKKTMKLSR |
Gene ID - Mouse | ENSMUSG00000029055 |
Gene ID - Rat | ENSRNOG00000014226 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links
Documents & Links for Anti PLCH2 pAb (ATL-HPA072705) | |
Datasheet | Anti PLCH2 pAb (ATL-HPA072705) Datasheet (External Link) |
Vendor Page | Anti PLCH2 pAb (ATL-HPA072705) at Atlas Antibodies |
Documents & Links for Anti PLCH2 pAb (ATL-HPA072705) | |
Datasheet | Anti PLCH2 pAb (ATL-HPA072705) Datasheet (External Link) |
Vendor Page | Anti PLCH2 pAb (ATL-HPA072705) |