Anti PLCH1 pAb (ATL-HPA057978)

Atlas Antibodies

Catalog No: ATL-HPA057978-25

• 

Product Description

Protein Description: phospholipase C, eta 1
Gene Name: PLCH1
Alternative Gene Name: DKFZp434C1372, KIAA1069, MGC117152, PLCeta1, PLCL3
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000036834: 54%, ENSRNOG00000009955: 54%
Entrez Gene ID: 23007
Uniprot ID: Q4KWH8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: ETTKHATNTVYETTCTPISKTKPDDDLSSKAKTAALESNLPGSPNTSRGWLPKSPTKGEDWETLKSCSPASSPDLTLEDVIADPTLCFNSGE
• Gene Sequence: ETTKHATNTVYETTCTPISKTKPDDDLSSKAKTAALESNLPGSPNTSRGWLPKSPTKGEDWETLKSCSPASSPDLTLEDVIADPTLCFNSGE
• Gene ID - Mouse: ENSMUSG00000036834
• Gene ID - Rat: ENSRNOG00000009955
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.