Protein Description: plasminogen activator, urokinase
Gene Name: PLAU
Alternative Gene Name: UPA, URK
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000021822: 70%, ENSRNOG00000010516: 70%
Entrez Gene ID: 5328
Uniprot ID: P00749
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: PLAU
Alternative Gene Name: UPA, URK
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000021822: 70%, ENSRNOG00000010516: 70%
Entrez Gene ID: 5328
Uniprot ID: P00749
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | KPSSPPEELKFQCGQKTLRPRFKIIGGEFTTIENQPWFAAIYRRHRGGSVTYVCGGSLISPCWVISATHCFIDYP |
| Documents & Links for Anti PLAU pAb (ATL-HPA070796) | |
| Datasheet | Anti PLAU pAb (ATL-HPA070796) Datasheet (External Link) |
| Vendor Page | Anti PLAU pAb (ATL-HPA070796) at Atlas |
| Documents & Links for Anti PLAU pAb (ATL-HPA070796) | |
| Datasheet | Anti PLAU pAb (ATL-HPA070796) Datasheet (External Link) |
| Vendor Page | Anti PLAU pAb (ATL-HPA070796) |