Protein Description: pleiomorphic adenoma gene 1
Gene Name: PLAG1
Alternative Gene Name: ZNF912
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000003282: 98%, ENSRNOG00000008846: 97%
Entrez Gene ID: 5324
Uniprot ID: Q6DJT9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: PLAG1
Alternative Gene Name: ZNF912
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000003282: 98%, ENSRNOG00000008846: 97%
Entrez Gene ID: 5324
Uniprot ID: Q6DJT9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | EPVDFLDPFTCNVSVPIKDELLPVMSLPSSELLSKPFTNTLQLNLYNTPFQSMQSSGSAHQ |
| Documents & Links for Anti PLAG1 pAb (ATL-HPA072290) | |
| Datasheet | Anti PLAG1 pAb (ATL-HPA072290) Datasheet (External Link) |
| Vendor Page | Anti PLAG1 pAb (ATL-HPA072290) at Atlas |
| Documents & Links for Anti PLAG1 pAb (ATL-HPA072290) | |
| Datasheet | Anti PLAG1 pAb (ATL-HPA072290) Datasheet (External Link) |
| Vendor Page | Anti PLAG1 pAb (ATL-HPA072290) |