Protein Description: placenta-specific 8
Gene Name: PLAC8
Alternative Gene Name: C15, onzin
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000029322: 84%, ENSRNOG00000002217: 86%
Entrez Gene ID: 51316
Uniprot ID: Q9NZF1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: PLAC8
Alternative Gene Name: C15, onzin
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000029322: 84%, ENSRNOG00000002217: 86%
Entrez Gene ID: 51316
Uniprot ID: Q9NZF1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Gene Sequence | MNECCLCGTSVAMRTLYRTRYGIPGSICDDYMATLCCPHCTLCQIKRDINRRRAMRTF |
Documents & Links for Anti PLAC8 pAb (ATL-HPA077912) | |
Datasheet | Anti PLAC8 pAb (ATL-HPA077912) Datasheet (External Link) |
Vendor Page | Anti PLAC8 pAb (ATL-HPA077912) at Atlas |
Documents & Links for Anti PLAC8 pAb (ATL-HPA077912) | |
Datasheet | Anti PLAC8 pAb (ATL-HPA077912) Datasheet (External Link) |
Vendor Page | Anti PLAC8 pAb (ATL-HPA077912) |