Anti PLAC8 pAb (ATL-HPA077912)

Catalog No:
ATL-HPA077912-25
$303.00
Protein Description: placenta-specific 8
Gene Name: PLAC8
Alternative Gene Name: C15, onzin
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000029322: 84%, ENSRNOG00000002217: 86%
Entrez Gene ID: 51316
Uniprot ID: Q9NZF1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Gene Sequence MNECCLCGTSVAMRTLYRTRYGIPGSICDDYMATLCCPHCTLCQIKRDINRRRAMRTF
Gene ID - Mouse ENSMUSG00000029322
Gene ID - Rat ENSMUSG00000029322
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Documents & Links for Anti PLAC8 pAb (ATL-HPA077912)
Datasheet Anti PLAC8 pAb (ATL-HPA077912) Datasheet (External Link)
Vendor Page Anti PLAC8 pAb (ATL-HPA077912) at Atlas

Documents & Links for Anti PLAC8 pAb (ATL-HPA077912)
Datasheet Anti PLAC8 pAb (ATL-HPA077912) Datasheet (External Link)
Vendor Page Anti PLAC8 pAb (ATL-HPA077912)