Polyclonal Antibody against Human PLAAT5, Gene description: phospholipase A and acyltransferase 5, Alternative Gene Names: HRASLS5, HRLP5, iNAT, PLAAT-5, Validated applications: ICC, Uniprot ID: Q96KN8, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | LVQLPAKQPPPGTLEQGRSIQQGEKAVVSLETTPSQKADWSSIPKPENEGKLIKQAAEGKPRPRPG |
| Gene ID - Mouse | ENSMUSG00000024973 |
| Gene ID - Rat | ENSMUSG00000024973 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti-PLAAT5 pAb (ATL-HPA079686) | |
| Vendor Page | Anti-PLAAT5 pAb (ATL-HPA079686) at Atlas |
| Documents & Links for Anti-PLAAT5 pAb (ATL-HPA079686) | |
| Vendor Page | Anti-PLAAT5 pAb (ATL-HPA079686) |