Anti PLA2G2E pAb (ATL-HPA064085)

Atlas Antibodies

Catalog No: ATL-HPA064085-25

• 

Product Description

Protein Description: phospholipase A2, group IIE
Gene Name: PLA2G2E
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000028751: 90%, ENSRNOG00000016838: 56%
Entrez Gene ID: 30814
Uniprot ID: Q9NZK7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: GNLVQFGVMIEKMTGKSALQYNDYGCYCGIG
• Gene Sequence: GNLVQFGVMIEKMTGKSALQYNDYGCYCGIG
• Gene ID - Mouse: ENSMUSG00000028751
• Gene ID - Rat: ENSRNOG00000016838
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.