Protein Description: phospholipase A2, group IIE
Gene Name: PLA2G2E
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000028751: 90%, ENSRNOG00000016838: 56%
Entrez Gene ID: 30814
Uniprot ID: Q9NZK7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: PLA2G2E
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000028751: 90%, ENSRNOG00000016838: 56%
Entrez Gene ID: 30814
Uniprot ID: Q9NZK7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | GNLVQFGVMIEKMTGKSALQYNDYGCYCGIG |
| Documents & Links for Anti PLA2G2E pAb (ATL-HPA064085) | |
| Datasheet | Anti PLA2G2E pAb (ATL-HPA064085) Datasheet (External Link) |
| Vendor Page | Anti PLA2G2E pAb (ATL-HPA064085) at Atlas |
| Documents & Links for Anti PLA2G2E pAb (ATL-HPA064085) | |
| Datasheet | Anti PLA2G2E pAb (ATL-HPA064085) Datasheet (External Link) |
| Vendor Page | Anti PLA2G2E pAb (ATL-HPA064085) |