Anti PLA2G1B pAb (ATL-HPA060803 w/enhanced validation)

Atlas Antibodies

Catalog No: ATL-HPA060803-25

• 
• 

Product Description

Protein Description: phospholipase A2, group IB (pancreas)
Gene Name: PLA2G1B
Alternative Gene Name: PLA2, PLA2A, PPLA2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000029522: 79%, ENSRNOG00000001153: 77%
Entrez Gene ID: 5319
Uniprot ID: P04054
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: ADSGISPRAVWQFRKMIKCVIPGSDPFLEYNNYGCYCGL
• Gene Sequence: ADSGISPRAVWQFRKMIKCVIPGSDPFLEYNNYGCYCGL
• Gene ID - Mouse: ENSMUSG00000029522
• Gene ID - Rat: ENSRNOG00000001153
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.