Protein Description: plakophilin 4
Gene Name: PKP4
Alternative Gene Name: p0071
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000026991: 89%, ENSRNOG00000005504: 90%
Entrez Gene ID: 8502
Uniprot ID: Q99569
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: PKP4
Alternative Gene Name: p0071
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000026991: 89%, ENSRNOG00000005504: 90%
Entrez Gene ID: 8502
Uniprot ID: Q99569
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | SYSDSGYQEAGSFHNSQNVSKADNRQQHSFIGSTNNHVVRNSRAEGQTLVQPSVANRAMRRVSSVPSRAQSPSYVISTGVSPSR |
| Documents & Links for Anti PKP4 pAb (ATL-HPA066647) | |
| Datasheet | Anti PKP4 pAb (ATL-HPA066647) Datasheet (External Link) |
| Vendor Page | Anti PKP4 pAb (ATL-HPA066647) at Atlas |
| Documents & Links for Anti PKP4 pAb (ATL-HPA066647) | |
| Datasheet | Anti PKP4 pAb (ATL-HPA066647) Datasheet (External Link) |
| Vendor Page | Anti PKP4 pAb (ATL-HPA066647) |