Anti PKNOX2 pAb (ATL-HPA066962)

Atlas Antibodies

Catalog No: ATL-HPA066962-25

• 

Product Description

Protein Description: PBX/knotted 1 homeobox 2
Gene Name: PKNOX2
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000035934: 99%, ENSRNOG00000028856: 97%
Entrez Gene ID: 63876
Uniprot ID: Q96KN3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: MMQHASPAPALTMMATQNVPPPPYQDSPQMTATAQPPSKAQAVHISAPSAAASTPVPSAPIDPQAQLEADKRAVYR
• Gene Sequence: MMQHASPAPALTMMATQNVPPPPYQDSPQMTATAQPPSKAQAVHISAPSAAASTPVPSAPIDPQAQLEADKRAVYR
• Gene ID - Mouse: ENSMUSG00000035934
• Gene ID - Rat: ENSRNOG00000028856
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.