Protein Description: PBX/knotted 1 homeobox 2
Gene Name: PKNOX2
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000035934: 99%, ENSRNOG00000028856: 97%
Entrez Gene ID: 63876
Uniprot ID: Q96KN3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: PKNOX2
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000035934: 99%, ENSRNOG00000028856: 97%
Entrez Gene ID: 63876
Uniprot ID: Q96KN3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | MMQHASPAPALTMMATQNVPPPPYQDSPQMTATAQPPSKAQAVHISAPSAAASTPVPSAPIDPQAQLEADKRAVYR |
| Documents & Links for Anti PKNOX2 pAb (ATL-HPA066962) | |
| Datasheet | Anti PKNOX2 pAb (ATL-HPA066962) Datasheet (External Link) |
| Vendor Page | Anti PKNOX2 pAb (ATL-HPA066962) at Atlas |
| Documents & Links for Anti PKNOX2 pAb (ATL-HPA066962) | |
| Datasheet | Anti PKNOX2 pAb (ATL-HPA066962) Datasheet (External Link) |
| Vendor Page | Anti PKNOX2 pAb (ATL-HPA066962) |