Anti PKNOX1 pAb (ATL-HPA057215)

Atlas Antibodies

Catalog No: ATL-HPA057215-25

• 

Product Description

Protein Description: PBX/knotted 1 homeobox 1
Gene Name: PKNOX1
Alternative Gene Name: PREP1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000006705: 98%, ENSRNOG00000001184: 98%
Entrez Gene ID: 5316
Uniprot ID: P55347
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: ATQTLSIDSYQDGQQMQVVTELKTEQDPNCSEPDAEGVSPP
• Gene Sequence: ATQTLSIDSYQDGQQMQVVTELKTEQDPNCSEPDAEGVSPP
• Gene ID - Mouse: ENSMUSG00000006705
• Gene ID - Rat: ENSRNOG00000001184
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.