Anti PKN3 pAb (ATL-HPA058305)

Atlas Antibodies

Catalog No: ATL-HPA058305-25

• 

Product Description

Protein Description: protein kinase N3
Gene Name: PKN3
Alternative Gene Name: PKNbeta
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000026785: 84%, ENSRNOG00000025892: 84%
Entrez Gene ID: 29941
Uniprot ID: Q6P5Z2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: DCIVNMDAPYPGFLSVQGLEFIQKLLQKCPEKRLGAGEQDAEEIKVQPFFRTTNWQALLARTIQ
• Gene Sequence: DCIVNMDAPYPGFLSVQGLEFIQKLLQKCPEKRLGAGEQDAEEIKVQPFFRTTNWQALLARTIQ
• Gene ID - Mouse: ENSMUSG00000026785
• Gene ID - Rat: ENSRNOG00000025892
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.