Anti PKN2 pAb (ATL-HPA057913)

Atlas Antibodies

Catalog No: ATL-HPA057913-25

• 
• 
• 

Product Description

Protein Description: protein kinase N2
Gene Name: PKN2
Alternative Gene Name: Pak-2, PRK2, PRKCL2, STK7
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000004591: 71%, ENSRNOG00000011317: 73%
Entrez Gene ID: 5586
Uniprot ID: Q16513
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: ASSLGEIDESSELRVLDIPGQDSETVFDIQNDRNSILPKSQSEYKPDTPQSGLEYSGIQELEDRRSQQRFQFNLQDFR
• Gene Sequence: ASSLGEIDESSELRVLDIPGQDSETVFDIQNDRNSILPKSQSEYKPDTPQSGLEYSGIQELEDRRSQQRFQFNLQDFR
• Gene ID - Mouse: ENSMUSG00000004591
• Gene ID - Rat: ENSRNOG00000011317
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.