Description
Product Description
Protein Description: protein kinase N2
Gene Name: PKN2
Alternative Gene Name: Pak-2, PRK2, PRKCL2, STK7
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000004591: 71%, ENSRNOG00000011317: 73%
Entrez Gene ID: 5586
Uniprot ID: Q16513
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: PKN2
Alternative Gene Name: Pak-2, PRK2, PRKCL2, STK7
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000004591: 71%, ENSRNOG00000011317: 73%
Entrez Gene ID: 5586
Uniprot ID: Q16513
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications
Product Specifications | |
Application | WB, ICC, IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | ASSLGEIDESSELRVLDIPGQDSETVFDIQNDRNSILPKSQSEYKPDTPQSGLEYSGIQELEDRRSQQRFQFNLQDFR |
Gene Sequence | ASSLGEIDESSELRVLDIPGQDSETVFDIQNDRNSILPKSQSEYKPDTPQSGLEYSGIQELEDRRSQQRFQFNLQDFR |
Gene ID - Mouse | ENSMUSG00000004591 |
Gene ID - Rat | ENSRNOG00000011317 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links
Documents & Links for Anti PKN2 pAb (ATL-HPA057913) | |
Datasheet | Anti PKN2 pAb (ATL-HPA057913) Datasheet (External Link) |
Vendor Page | Anti PKN2 pAb (ATL-HPA057913) at Atlas Antibodies |
Documents & Links for Anti PKN2 pAb (ATL-HPA057913) | |
Datasheet | Anti PKN2 pAb (ATL-HPA057913) Datasheet (External Link) |
Vendor Page | Anti PKN2 pAb (ATL-HPA057913) |