Protein Description: polycystic kidney disease 2-like 2
Gene Name: PKD2L2
Alternative Gene Name: TRPP5
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000014503: 77%, ENSRNOG00000025489: 82%
Entrez Gene ID: 27039
Uniprot ID: Q9NZM6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: PKD2L2
Alternative Gene Name: TRPP5
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000014503: 77%, ENSRNOG00000025489: 82%
Entrez Gene ID: 27039
Uniprot ID: Q9NZM6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | EDKKTKGSGDLAEQARREGFDENEIQNAEQMKKWKERLEKKYYSMEIQDDYQPVTQEEFRELFLYAVELEKELHYINLKLNQVVRKVS |
| Documents & Links for Anti PKD2L2 pAb (ATL-HPA041903) | |
| Datasheet | Anti PKD2L2 pAb (ATL-HPA041903) Datasheet (External Link) |
| Vendor Page | Anti PKD2L2 pAb (ATL-HPA041903) at Atlas |
| Documents & Links for Anti PKD2L2 pAb (ATL-HPA041903) | |
| Datasheet | Anti PKD2L2 pAb (ATL-HPA041903) Datasheet (External Link) |
| Vendor Page | Anti PKD2L2 pAb (ATL-HPA041903) |