Protein Description: phosphatidylinositol-5-phosphate 4-kinase, type II, alpha
Gene Name: PIP4K2A
Alternative Gene Name: PIP5K2A, PIP5KIIA, PIP5KIIalpha
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000026737: 94%, ENSRNOG00000016670: 94%
Entrez Gene ID: 5305
Uniprot ID: P48426
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: PIP4K2A
Alternative Gene Name: PIP5K2A, PIP5KIIA, PIP5KIIalpha
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000026737: 94%, ENSRNOG00000016670: 94%
Entrez Gene ID: 5305
Uniprot ID: P48426
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Gene Sequence | PGNTLNSSPPLAPGEFDPNIDVYGIKCHENSPRKE |
Documents & Links for Anti PIP4K2A pAb (ATL-HPA065440) | |
Datasheet | Anti PIP4K2A pAb (ATL-HPA065440) Datasheet (External Link) |
Vendor Page | Anti PIP4K2A pAb (ATL-HPA065440) at Atlas |
Documents & Links for Anti PIP4K2A pAb (ATL-HPA065440) | |
Datasheet | Anti PIP4K2A pAb (ATL-HPA065440) Datasheet (External Link) |
Vendor Page | Anti PIP4K2A pAb (ATL-HPA065440) |