Protein Description: PIN2/TERF1 interacting, telomerase inhibitor 1
Gene Name: PINX1
Alternative Gene Name: FLJ20565, LPTL, LPTS, MGC8850, PinX1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000021958: 83%, ENSRNOG00000012012: 83%
Entrez Gene ID: 54984
Uniprot ID: Q96BK5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: PINX1
Alternative Gene Name: FLJ20565, LPTL, LPTS, MGC8850, PinX1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000021958: 83%, ENSRNOG00000012012: 83%
Entrez Gene ID: 54984
Uniprot ID: Q96BK5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | WB, IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Gene Sequence | LNTCHGQETTDSSDKKEKKSFSLEEKSKISKNRVHYMKFTKGKDLSSRSKTDLDCIFGKRQSKKTPEGDASPSTP |
Documents & Links for Anti PINX1 pAb (ATL-HPA023139) | |
Datasheet | Anti PINX1 pAb (ATL-HPA023139) Datasheet (External Link) |
Vendor Page | Anti PINX1 pAb (ATL-HPA023139) at Atlas |
Documents & Links for Anti PINX1 pAb (ATL-HPA023139) | |
Datasheet | Anti PINX1 pAb (ATL-HPA023139) Datasheet (External Link) |
Vendor Page | Anti PINX1 pAb (ATL-HPA023139) |