Description
Product Description
Protein Description: PTEN induced putative kinase 1
Gene Name: PINK1
Alternative Gene Name: PARK6
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000028756: 85%, ENSRNOG00000015385: 87%
Entrez Gene ID: 65018
Uniprot ID: Q9BXM7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: PINK1
Alternative Gene Name: PARK6
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000028756: 85%, ENSRNOG00000015385: 87%
Entrez Gene ID: 65018
Uniprot ID: Q9BXM7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | GVDHLVQQGIAHRDLKSDNILVELDPDGCPWLVIADFGCCLADESIGLQLPFSSWYVDRGGNGCLMAPEVSTARPGPRAVIDYSKADAWAVGAIAYEIFGLVNPFYGQGKAHLESRSYQEAQLP |
Gene Sequence | GVDHLVQQGIAHRDLKSDNILVELDPDGCPWLVIADFGCCLADESIGLQLPFSSWYVDRGGNGCLMAPEVSTARPGPRAVIDYSKADAWAVGAIAYEIFGLVNPFYGQGKAHLESRSYQEAQLP |
Gene ID - Mouse | ENSMUSG00000028756 |
Gene ID - Rat | ENSRNOG00000015385 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links
Documents & Links for Anti PINK1 pAb (ATL-HPA001931) | |
Datasheet | Anti PINK1 pAb (ATL-HPA001931) Datasheet (External Link) |
Vendor Page | Anti PINK1 pAb (ATL-HPA001931) at Atlas Antibodies |
Documents & Links for Anti PINK1 pAb (ATL-HPA001931) | |
Datasheet | Anti PINK1 pAb (ATL-HPA001931) Datasheet (External Link) |
Vendor Page | Anti PINK1 pAb (ATL-HPA001931) |
Citations
Citations for Anti PINK1 pAb (ATL-HPA001931) – 3 Found |
Aparicio, I M; Espino, J; Bejarano, I; Gallardo-Soler, A; Campo, M L; Salido, G M; Pariente, J A; Peña, F J; Tapia, J A. Autophagy-related proteins are functionally active in human spermatozoa and may be involved in the regulation of cell survival and motility. Scientific Reports. 2016;6( 27633131):33647. PubMed |
Safiulina, Dzhamilja; Kuum, Malle; Choubey, Vinay; Gogichaishvili, Nana; Liiv, Joanna; Hickey, Miriam A; Cagalinec, Michal; Mandel, Merle; Zeb, Akbar; Liiv, Mailis; Kaasik, Allen. Miro proteins prime mitochondria for Parkin translocation and mitophagy. The Embo Journal. 2019;38(2) PubMed |
Choubey, Vinay; Cagalinec, Michal; Liiv, Joanna; Safiulina, Dzhamilja; Hickey, Miriam A; Kuum, Malle; Liiv, Mailis; Anwar, Tahira; Eskelinen, Eeva-Liisa; Kaasik, Allen. BECN1 is involved in the initiation of mitophagy: it facilitates PARK2 translocation to mitochondria. Autophagy. 2014;10(6):1105-19. PubMed |