Protein Description: Pim-3 proto-oncogene, serine/threonine kinase
Gene Name: PIM3
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000035828: 96%, ENSRNOG00000000529: 61%
Entrez Gene ID: 415116
Uniprot ID: Q86V86
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: PIM3
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000035828: 96%, ENSRNOG00000000529: 61%
Entrez Gene ID: 415116
Uniprot ID: Q86V86
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | FGTVYAGSRIADGLPVAVKHVVKERVTEWGSLGGATVPLEVVLLR |
| Documents & Links for Anti PIM3 pAb (ATL-HPA068758) | |
| Datasheet | Anti PIM3 pAb (ATL-HPA068758) Datasheet (External Link) |
| Vendor Page | Anti PIM3 pAb (ATL-HPA068758) at Atlas |
| Documents & Links for Anti PIM3 pAb (ATL-HPA068758) | |
| Datasheet | Anti PIM3 pAb (ATL-HPA068758) Datasheet (External Link) |
| Vendor Page | Anti PIM3 pAb (ATL-HPA068758) |