Anti PIK3R3 pAb (ATL-HPA071988)

Atlas Antibodies

Catalog No: ATL-HPA071988-25

• 

Product Description

Protein Description: phosphoinositide-3-kinase, regulatory subunit 3 (gamma)
Gene Name: PIK3R3
Alternative Gene Name: p55
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000028698: 100%, ENSRNOG00000000145: 100%
Entrez Gene ID: 8503
Uniprot ID: Q92569
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: MYNTVWSMDRDDADWREVMMPYSTELIFYIEMD
• Gene Sequence: MYNTVWSMDRDDADWREVMMPYSTELIFYIEMD
• Gene ID - Mouse: ENSMUSG00000028698
• Gene ID - Rat: ENSRNOG00000000145
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.