Protein Description: phosphoinositide-3-kinase, regulatory subunit 3 (gamma)
Gene Name: PIK3R3
Alternative Gene Name: p55
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000028698: 100%, ENSRNOG00000000145: 100%
Entrez Gene ID: 8503
Uniprot ID: Q92569
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: PIK3R3
Alternative Gene Name: p55
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000028698: 100%, ENSRNOG00000000145: 100%
Entrez Gene ID: 8503
Uniprot ID: Q92569
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Gene Sequence | MYNTVWSMDRDDADWREVMMPYSTELIFYIEMD |
Documents & Links for Anti PIK3R3 pAb (ATL-HPA071988) | |
Datasheet | Anti PIK3R3 pAb (ATL-HPA071988) Datasheet (External Link) |
Vendor Page | Anti PIK3R3 pAb (ATL-HPA071988) at Atlas |
Documents & Links for Anti PIK3R3 pAb (ATL-HPA071988) | |
Datasheet | Anti PIK3R3 pAb (ATL-HPA071988) Datasheet (External Link) |
Vendor Page | Anti PIK3R3 pAb (ATL-HPA071988) |