Protein Description: phosphoinositide-3-kinase adaptor protein 1
Gene Name: PIK3AP1
Alternative Gene Name: BCAP, FLJ35564
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000025017: 91%, ENSRNOG00000013309: 94%
Entrez Gene ID: 118788
Uniprot ID: Q6ZUJ8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: PIK3AP1
Alternative Gene Name: BCAP, FLJ35564
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000025017: 91%, ENSRNOG00000013309: 94%
Entrez Gene ID: 118788
Uniprot ID: Q6ZUJ8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | WB, ICC, IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Gene Sequence | EWQLNQKKRSESFRFQQENLKRLRDSITRRQREKQKSGKQTDLEITVPIRHSQHLPAKVEFGVYESGPRKSVIPPRTELRRGDWK |
Documents & Links for Anti PIK3AP1 pAb (ATL-HPA038452 w/enhanced validation) | |
Datasheet | Anti PIK3AP1 pAb (ATL-HPA038452 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti PIK3AP1 pAb (ATL-HPA038452 w/enhanced validation) at Atlas |
Documents & Links for Anti PIK3AP1 pAb (ATL-HPA038452 w/enhanced validation) | |
Datasheet | Anti PIK3AP1 pAb (ATL-HPA038452 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti PIK3AP1 pAb (ATL-HPA038452 w/enhanced validation) |