Protein Description: PIH1 domain containing 3
Gene Name: PIH1D3
Alternative Gene Name: CXorf41, MGC35261, NYSAR97
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000042433: 55%, ENSRNOG00000054900: 52%
Entrez Gene ID: 139212
Uniprot ID: Q9NQM4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: PIH1D3
Alternative Gene Name: CXorf41, MGC35261, NYSAR97
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000042433: 55%, ENSRNOG00000054900: 52%
Entrez Gene ID: 139212
Uniprot ID: Q9NQM4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | MDSENMKTENMESQNVDFESVSSVTALEALSKLLNPEEEDDSDYGQTNGLSTIGAMGPGNIGPP |
| Documents & Links for Anti PIH1D3 pAb (ATL-HPA072496 w/enhanced validation) | |
| Datasheet | Anti PIH1D3 pAb (ATL-HPA072496 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti PIH1D3 pAb (ATL-HPA072496 w/enhanced validation) at Atlas |
| Documents & Links for Anti PIH1D3 pAb (ATL-HPA072496 w/enhanced validation) | |
| Datasheet | Anti PIH1D3 pAb (ATL-HPA072496 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti PIH1D3 pAb (ATL-HPA072496 w/enhanced validation) |
| Citations for Anti PIH1D3 pAb (ATL-HPA072496 w/enhanced validation) – 1 Found |
| Liu, Zhen; Nguyen, Quynh P H; Guan, Qingxu; Albulescu, Alexandra; Erdman, Lauren; Mahdaviyeh, Yasaman; Kang, Jasmine; Ouyang, Hong; Hegele, Richard G; Moraes, Theo; Goldenberg, Anna; Dell, Sharon D; Mennella, Vito. A quantitative super-resolution imaging toolbox for diagnosis of motile ciliopathies. Science Translational Medicine. 2020;12(535) PubMed |