Protein Description: phosphatidylinositol glycan anchor biosynthesis class X
Gene Name: PIGX
Alternative Gene Name: FLJ20522
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000023791: 76%, ENSRNOG00000033623: 74%
Entrez Gene ID: 54965
Uniprot ID: Q8TBF5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: PIGX
Alternative Gene Name: FLJ20522
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000023791: 76%, ENSRNOG00000033623: 74%
Entrez Gene ID: 54965
Uniprot ID: Q8TBF5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | DQEFPILKCWAHSEVAAPCALENEDICQWNKMKYKSVYKNVILQVPVGLT |
| Documents & Links for Anti PIGX pAb (ATL-HPA073301) | |
| Datasheet | Anti PIGX pAb (ATL-HPA073301) Datasheet (External Link) |
| Vendor Page | Anti PIGX pAb (ATL-HPA073301) at Atlas |
| Documents & Links for Anti PIGX pAb (ATL-HPA073301) | |
| Datasheet | Anti PIGX pAb (ATL-HPA073301) Datasheet (External Link) |
| Vendor Page | Anti PIGX pAb (ATL-HPA073301) |