Description
Product Description
Protein Description: polymeric immunoglobulin receptor
Gene Name: PIGR
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000026417: 58%, ENSRNOG00000004405: 55%
Entrez Gene ID: 5284
Uniprot ID: P01833
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: PIGR
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000026417: 58%, ENSRNOG00000004405: 55%
Entrez Gene ID: 5284
Uniprot ID: P01833
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | GDTLWRTTVEIKIIEGEPNLKVPGNVTAVLGETLKVPCHFPCKFSSYEKYWCKWNNTGCQALPSQDEGPSKAFVNCDENSRLVSLTLNLVTRADEGWYWCGVKQGHFYGETAAVYVAVEERKAAGSRDVSLAKADAAPDEKVL |
Gene Sequence | GDTLWRTTVEIKIIEGEPNLKVPGNVTAVLGETLKVPCHFPCKFSSYEKYWCKWNNTGCQALPSQDEGPSKAFVNCDENSRLVSLTLNLVTRADEGWYWCGVKQGHFYGETAAVYVAVEERKAAGSRDVSLAKADAAPDEKVL |
Gene ID - Mouse | ENSMUSG00000026417 |
Gene ID - Rat | ENSRNOG00000004405 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links
Documents & Links for Anti PIGR pAb (ATL-HPA006154 w/enhanced validation) | |
Datasheet | Anti PIGR pAb (ATL-HPA006154 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti PIGR pAb (ATL-HPA006154 w/enhanced validation) at Atlas Antibodies |
Documents & Links for Anti PIGR pAb (ATL-HPA006154 w/enhanced validation) | |
Datasheet | Anti PIGR pAb (ATL-HPA006154 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti PIGR pAb (ATL-HPA006154 w/enhanced validation) |