Anti PIGR pAb (ATL-HPA006154 w/enhanced validation)

Atlas Antibodies

Catalog No: ATL-HPA006154-25

• 

Product Description

Protein Description: polymeric immunoglobulin receptor
Gene Name: PIGR
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000026417: 58%, ENSRNOG00000004405: 55%
Entrez Gene ID: 5284
Uniprot ID: P01833
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: GDTLWRTTVEIKIIEGEPNLKVPGNVTAVLGETLKVPCHFPCKFSSYEKYWCKWNNTGCQALPSQDEGPSKAFVNCDENSRLVSLTLNLVTRADEGWYWCGVKQGHFYGETAAVYVAVEERKAAGSRDVSLAKADAAPDEKVL
• Gene Sequence: GDTLWRTTVEIKIIEGEPNLKVPGNVTAVLGETLKVPCHFPCKFSSYEKYWCKWNNTGCQALPSQDEGPSKAFVNCDENSRLVSLTLNLVTRADEGWYWCGVKQGHFYGETAAVYVAVEERKAAGSRDVSLAKADAAPDEKVL
• Gene ID - Mouse: ENSMUSG00000026417
• Gene ID - Rat: ENSRNOG00000004405
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.