Description
Product Description
Protein Description: phosphatidylinositol glycan anchor biosynthesis, class Q
Gene Name: PIGQ
Alternative Gene Name: GPI1, hGPI1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000025728: 98%, ENSRNOG00000020140: 98%
Entrez Gene ID: 9091
Uniprot ID: Q9BRB3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: PIGQ
Alternative Gene Name: GPI1, hGPI1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000025728: 98%, ENSRNOG00000020140: 98%
Entrez Gene ID: 9091
Uniprot ID: Q9BRB3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications
| Product Specifications | |
| Application | ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | YVYGARLYCLKIHGLSSLWRLFRGKKWNVLRQRVDSCSYDLDQ |
| Gene Sequence | YVYGARLYCLKIHGLSSLWRLFRGKKWNVLRQRVDSCSYDLDQ |
| Gene ID - Mouse | ENSMUSG00000025728 |
| Gene ID - Rat | ENSRNOG00000020140 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links
| Documents & Links for Anti PIGQ pAb (ATL-HPA061414) | |
| Datasheet | Anti PIGQ pAb (ATL-HPA061414) Datasheet (External Link) |
| Vendor Page | Anti PIGQ pAb (ATL-HPA061414) at Atlas Antibodies |
| Documents & Links for Anti PIGQ pAb (ATL-HPA061414) | |
| Datasheet | Anti PIGQ pAb (ATL-HPA061414) Datasheet (External Link) |
| Vendor Page | Anti PIGQ pAb (ATL-HPA061414) |