Description
Product Description
Protein Description: phosphatidylinositol glycan anchor biosynthesis, class K
Gene Name: PIGK
Alternative Gene Name: GPI8, hGPI8
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000039047: 100%, ENSRNOG00000042359: 100%
Entrez Gene ID: 10026
Uniprot ID: Q92643
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: PIGK
Alternative Gene Name: GPI8, hGPI8
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000039047: 100%, ENSRNOG00000042359: 100%
Entrez Gene ID: 10026
Uniprot ID: Q92643
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | DTCQGASMYERFYSPNIMALASSQVGEDSLSHQPDPAIGVHLMDRYTFYVLEFLEEINPASQTNMNDLFQVCPKSL |
Gene Sequence | DTCQGASMYERFYSPNIMALASSQVGEDSLSHQPDPAIGVHLMDRYTFYVLEFLEEINPASQTNMNDLFQVCPKSL |
Gene ID - Mouse | ENSMUSG00000039047 |
Gene ID - Rat | ENSRNOG00000042359 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links
Documents & Links for Anti PIGK pAb (ATL-HPA057040) | |
Datasheet | Anti PIGK pAb (ATL-HPA057040) Datasheet (External Link) |
Vendor Page | Anti PIGK pAb (ATL-HPA057040) at Atlas Antibodies |
Documents & Links for Anti PIGK pAb (ATL-HPA057040) | |
Datasheet | Anti PIGK pAb (ATL-HPA057040) Datasheet (External Link) |
Vendor Page | Anti PIGK pAb (ATL-HPA057040) |