Anti PIDD1 pAb (ATL-HPA066948)

Atlas Antibodies

Catalog No: ATL-HPA066948-25

• 

Product Description

Protein Description: p53-induced death domain protein 1
Gene Name: PIDD1
Alternative Gene Name: DKFZp434D229, LRDD, MGC16925, PIDD
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000025507: 84%, ENSRNOG00000018710: 86%
Entrez Gene ID: 55367
Uniprot ID: Q9HB75
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: GVSYREVQRIRHEFRDDLDEQIRHMLFSWAERQAGQPGAVGLLVQALEQSDRQDVAEEVRAVLELGRRKYQDSIRRMGLA
• Gene Sequence: GVSYREVQRIRHEFRDDLDEQIRHMLFSWAERQAGQPGAVGLLVQALEQSDRQDVAEEVRAVLELGRRKYQDSIRRMGLA
• Gene ID - Mouse: ENSMUSG00000025507
• Gene ID - Rat: ENSRNOG00000018710
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.