Protein Description: p53-induced death domain protein 1
Gene Name: PIDD1
Alternative Gene Name: DKFZp434D229, LRDD, MGC16925, PIDD
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000025507: 84%, ENSRNOG00000018710: 86%
Entrez Gene ID: 55367
Uniprot ID: Q9HB75
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: PIDD1
Alternative Gene Name: DKFZp434D229, LRDD, MGC16925, PIDD
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000025507: 84%, ENSRNOG00000018710: 86%
Entrez Gene ID: 55367
Uniprot ID: Q9HB75
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | GVSYREVQRIRHEFRDDLDEQIRHMLFSWAERQAGQPGAVGLLVQALEQSDRQDVAEEVRAVLELGRRKYQDSIRRMGLA |
| Documents & Links for Anti PIDD1 pAb (ATL-HPA066948) | |
| Datasheet | Anti PIDD1 pAb (ATL-HPA066948) Datasheet (External Link) |
| Vendor Page | Anti PIDD1 pAb (ATL-HPA066948) at Atlas |
| Documents & Links for Anti PIDD1 pAb (ATL-HPA066948) | |
| Datasheet | Anti PIDD1 pAb (ATL-HPA066948) Datasheet (External Link) |
| Vendor Page | Anti PIDD1 pAb (ATL-HPA066948) |