Anti PICK1 pAb (ATL-HPA067384)

Catalog No:
ATL-HPA067384-25
$401.00
Protein Description: protein interacting with PRKCA 1
Gene Name: PICK1
Alternative Gene Name: dJ1039K5, MGC15204, PRKCABP
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000068206: 100%, ENSRNOG00000011507: 100%
Entrez Gene ID: 9463
Uniprot ID: Q9NRD5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Gene Sequence LTIKKYLDVKFEYLSYCLKVKEMDDEEYSCIALGEPLYRVSTGNYEYRLILRCRQEARARFSQMRKDVLEKMELLD

Documents & Links for Anti PICK1 pAb (ATL-HPA067384)
Datasheet Anti PICK1 pAb (ATL-HPA067384) Datasheet (External Link)
Vendor Page Anti PICK1 pAb (ATL-HPA067384) at Atlas

Documents & Links for Anti PICK1 pAb (ATL-HPA067384)
Datasheet Anti PICK1 pAb (ATL-HPA067384) Datasheet (External Link)
Vendor Page Anti PICK1 pAb (ATL-HPA067384)