Protein Description: protein interacting with PRKCA 1
Gene Name: PICK1
Alternative Gene Name: dJ1039K5, MGC15204, PRKCABP
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000068206: 100%, ENSRNOG00000011507: 100%
Entrez Gene ID: 9463
Uniprot ID: Q9NRD5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: PICK1
Alternative Gene Name: dJ1039K5, MGC15204, PRKCABP
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000068206: 100%, ENSRNOG00000011507: 100%
Entrez Gene ID: 9463
Uniprot ID: Q9NRD5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Gene Sequence | LTIKKYLDVKFEYLSYCLKVKEMDDEEYSCIALGEPLYRVSTGNYEYRLILRCRQEARARFSQMRKDVLEKMELLD |
Documents & Links for Anti PICK1 pAb (ATL-HPA067384) | |
Datasheet | Anti PICK1 pAb (ATL-HPA067384) Datasheet (External Link) |
Vendor Page | Anti PICK1 pAb (ATL-HPA067384) at Atlas |
Documents & Links for Anti PICK1 pAb (ATL-HPA067384) | |
Datasheet | Anti PICK1 pAb (ATL-HPA067384) Datasheet (External Link) |
Vendor Page | Anti PICK1 pAb (ATL-HPA067384) |