Description
Product Description
Protein Description: progesterone immunomodulatory binding factor 1
Gene Name: PIBF1
Alternative Gene Name: C13orf24, CEP90
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000022064: 94%, ENSRNOG00000009208: 91%
Entrez Gene ID: 10464
Uniprot ID: Q8WXW3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: PIBF1
Alternative Gene Name: C13orf24, CEP90
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000022064: 94%, ENSRNOG00000009208: 91%
Entrez Gene ID: 10464
Uniprot ID: Q8WXW3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | KELDEIIMQTAEIENEDEAERVLFSYGYGANVPTTAKRRLKQSVHLARRVLQLEKQNSLILKDLEHRKDQVTQLSQELDRANSLLNQTQQPYRYLIESV |
Gene Sequence | KELDEIIMQTAEIENEDEAERVLFSYGYGANVPTTAKRRLKQSVHLARRVLQLEKQNSLILKDLEHRKDQVTQLSQELDRANSLLNQTQQPYRYLIESV |
Gene ID - Mouse | ENSMUSG00000022064 |
Gene ID - Rat | ENSRNOG00000009208 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links
Documents & Links for Anti PIBF1 pAb (ATL-HPA066120) | |
Datasheet | Anti PIBF1 pAb (ATL-HPA066120) Datasheet (External Link) |
Vendor Page | Anti PIBF1 pAb (ATL-HPA066120) at Atlas Antibodies |
Documents & Links for Anti PIBF1 pAb (ATL-HPA066120) | |
Datasheet | Anti PIBF1 pAb (ATL-HPA066120) Datasheet (External Link) |
Vendor Page | Anti PIBF1 pAb (ATL-HPA066120) |