![Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10 | Lane 2: RT4 | Lane 3: U-251 MG | Lane 4: Human Plasma | Lane 5: Liver | Lane 6: Tonsil](https://cdn11.bigcommerce.com/s-ydswqc5qsc/images/stencil/1280x1280/products/101552/181677/atl-hpa076008_anti-pias4-pab-atl-hpa076008_63345__63563.1681138058.jpg?c=2 "Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10 | Lane 2: RT4 | Lane 3: U-251 MG | Lane 4: Human Plasma | Lane 5: Liver | Lane 6: Tonsil")
![Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10 | Lane 2: RT4 | Lane 3: U-251 MG | Lane 4: Human Plasma | Lane 5: Liver | Lane 6: Tonsil](https://cdn11.bigcommerce.com/s-ydswqc5qsc/images/stencil/500x659/products/101552/181677/atl-hpa076008_anti-pias4-pab-atl-hpa076008_63345__63563.1681138058.jpg?c=2 "Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10 | Lane 2: RT4 | Lane 3: U-251 MG | Lane 4: Human Plasma | Lane 5: Liver | Lane 6: Tonsil")
Protein Description: protein inhibitor of activated STAT 4
Gene Name: PIAS4
Alternative Gene Name: FLJ12419, Piasg, PIASY, ZMIZ6
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000004934: 79%, ENSRNOG00000020230: 80%
Entrez Gene ID: 51588
Uniprot ID: Q8N2W9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: PIAS4
Alternative Gene Name: FLJ12419, Piasg, PIASY, ZMIZ6
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000004934: 79%, ENSRNOG00000020230: 80%
Entrez Gene ID: 51588
Uniprot ID: Q8N2W9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | PYDQLIIDGLLSKILSECEDADEIEYLVDGSWCPIRAEKERSCSPQGAILVLGPSDANGLLPAPSVNGSGA |
| Documents & Links for Anti PIAS4 pAb (ATL-HPA076008) | |
| Datasheet | Anti PIAS4 pAb (ATL-HPA076008) Datasheet (External Link) |
| Vendor Page | Anti PIAS4 pAb (ATL-HPA076008) at Atlas |
| Documents & Links for Anti PIAS4 pAb (ATL-HPA076008) | |
| Datasheet | Anti PIAS4 pAb (ATL-HPA076008) Datasheet (External Link) |
| Vendor Page | Anti PIAS4 pAb (ATL-HPA076008) |