Anti PIAS3 pAb (ATL-HPA067383)

Catalog No:
ATL-HPA067383-25
$401.00
Protein Description: protein inhibitor of activated STAT, 3
Gene Name: PIAS3
Alternative Gene Name: FLJ14651, ZMIZ5
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000028101: 93%, ENSRNOG00000021218: 90%
Entrez Gene ID: 10401
Uniprot ID: Q9Y6X2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Gene Sequence ITSLDEQDALGHFFQYRGTPSHFLGPLAPTLGSSHCSATPAPPPGRVSSIVAPGGALREGHGGPLPSGPSLTGCRSDIISLD

Documents & Links for Anti PIAS3 pAb (ATL-HPA067383)
Datasheet Anti PIAS3 pAb (ATL-HPA067383) Datasheet (External Link)
Vendor Page Anti PIAS3 pAb (ATL-HPA067383) at Atlas

Documents & Links for Anti PIAS3 pAb (ATL-HPA067383)
Datasheet Anti PIAS3 pAb (ATL-HPA067383) Datasheet (External Link)
Vendor Page Anti PIAS3 pAb (ATL-HPA067383)