Description
Product Description
Protein Description: protein inhibitor of activated STAT, 3
Gene Name: PIAS3
Alternative Gene Name: FLJ14651, ZMIZ5
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000028101: 93%, ENSRNOG00000021218: 90%
Entrez Gene ID: 10401
Uniprot ID: Q9Y6X2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: PIAS3
Alternative Gene Name: FLJ14651, ZMIZ5
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000028101: 93%, ENSRNOG00000021218: 90%
Entrez Gene ID: 10401
Uniprot ID: Q9Y6X2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | ITSLDEQDALGHFFQYRGTPSHFLGPLAPTLGSSHCSATPAPPPGRVSSIVAPGGALREGHGGPLPSGPSLTGCRSDIISLD |
Gene Sequence | ITSLDEQDALGHFFQYRGTPSHFLGPLAPTLGSSHCSATPAPPPGRVSSIVAPGGALREGHGGPLPSGPSLTGCRSDIISLD |
Gene ID - Mouse | ENSMUSG00000028101 |
Gene ID - Rat | ENSRNOG00000021218 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links
Documents & Links for Anti PIAS3 pAb (ATL-HPA067383) | |
Datasheet | Anti PIAS3 pAb (ATL-HPA067383) Datasheet (External Link) |
Vendor Page | Anti PIAS3 pAb (ATL-HPA067383) at Atlas Antibodies |
Documents & Links for Anti PIAS3 pAb (ATL-HPA067383) | |
Datasheet | Anti PIAS3 pAb (ATL-HPA067383) Datasheet (External Link) |
Vendor Page | Anti PIAS3 pAb (ATL-HPA067383) |