Protein Description: phosphatidylinositol 4-kinase, catalytic, alpha
Gene Name: PI4KA
Alternative Gene Name: PI4K-ALPHA, pi4K230, PIK4CA
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000041720: 100%, ENSRNOG00000060045: 100%
Entrez Gene ID: 5297
Uniprot ID: P42356
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: PI4KA
Alternative Gene Name: PI4K-ALPHA, pi4K230, PIK4CA
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000041720: 100%, ENSRNOG00000060045: 100%
Entrez Gene ID: 5297
Uniprot ID: P42356
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | DMLALQIIDLFKNIFQLVGLDLFVFPYRVVATAPGCGVIECIPDCTSRDQLGRQTDFGMYDYFTRQYG |
| Documents & Links for Anti PI4KA pAb (ATL-HPA075515) | |
| Datasheet | Anti PI4KA pAb (ATL-HPA075515) Datasheet (External Link) |
| Vendor Page | Anti PI4KA pAb (ATL-HPA075515) at Atlas |
| Documents & Links for Anti PI4KA pAb (ATL-HPA075515) | |
| Datasheet | Anti PI4KA pAb (ATL-HPA075515) Datasheet (External Link) |
| Vendor Page | Anti PI4KA pAb (ATL-HPA075515) |