Protein Description: peptidase inhibitor 16
Gene Name: PI16
Alternative Gene Name: CD364, dJ90K10.5, MGC45378, MSMBBP
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000024011: 49%, ENSRNOG00000000525: 48%
Entrez Gene ID: 221476
Uniprot ID: Q6UXB8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: PI16
Alternative Gene Name: CD364, dJ90K10.5, MGC45378, MSMBBP
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000024011: 49%, ENSRNOG00000000525: 48%
Entrez Gene ID: 221476
Uniprot ID: Q6UXB8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Gene Sequence | TGARELLPHAQEEAEAEAELPPSSEVLASVFPAQDKPGELQATLDHTGHTSSKSLPNFPNTSATANATGG |
Documents & Links for Anti PI16 pAb (ATL-HPA076574) | |
Datasheet | Anti PI16 pAb (ATL-HPA076574) Datasheet (External Link) |
Vendor Page | Anti PI16 pAb (ATL-HPA076574) at Atlas |
Documents & Links for Anti PI16 pAb (ATL-HPA076574) | |
Datasheet | Anti PI16 pAb (ATL-HPA076574) Datasheet (External Link) |
Vendor Page | Anti PI16 pAb (ATL-HPA076574) |