Protein Description: 5-phosphohydroxy-L-lysine phospho-lyase
Gene Name: PHYKPL
Alternative Gene Name: AGXT2L2, MGC15875
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000020359: 71%, ENSRNOG00000047933: 73%
Entrez Gene ID: 85007
Uniprot ID: Q8IUZ5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: PHYKPL
Alternative Gene Name: AGXT2L2, MGC15875
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000020359: 71%, ENSRNOG00000047933: 73%
Entrez Gene ID: 85007
Uniprot ID: Q8IUZ5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | VLNVLEKEQLQDHATSVGSFLMQLLGQQKIKHPIVGDVRGV |
| Documents & Links for Anti PHYKPL pAb (ATL-HPA063608) | |
| Datasheet | Anti PHYKPL pAb (ATL-HPA063608) Datasheet (External Link) |
| Vendor Page | Anti PHYKPL pAb (ATL-HPA063608) at Atlas |
| Documents & Links for Anti PHYKPL pAb (ATL-HPA063608) | |
| Datasheet | Anti PHYKPL pAb (ATL-HPA063608) Datasheet (External Link) |
| Vendor Page | Anti PHYKPL pAb (ATL-HPA063608) |