Protein Description: PHD and ring finger domains 1
Gene Name: PHRF1
Alternative Gene Name: KIAA1542, PPP1R125, RNF221
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000038611: 64%, ENSRNOG00000017299: 64%
Entrez Gene ID: 57661
Uniprot ID: Q9P1Y6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: PHRF1
Alternative Gene Name: KIAA1542, PPP1R125, RNF221
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000038611: 64%, ENSRNOG00000017299: 64%
Entrez Gene ID: 57661
Uniprot ID: Q9P1Y6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | ASGRVQEAARPEEVVSQTPLLRSRALVKRVTWNLQESESSAPAEDRAPRAPLHRPQKPREGAWDMEDVAPTGVRQAFSELPF |
| Documents & Links for Anti PHRF1 pAb (ATL-HPA062933) | |
| Datasheet | Anti PHRF1 pAb (ATL-HPA062933) Datasheet (External Link) |
| Vendor Page | Anti PHRF1 pAb (ATL-HPA062933) at Atlas |
| Documents & Links for Anti PHRF1 pAb (ATL-HPA062933) | |
| Datasheet | Anti PHRF1 pAb (ATL-HPA062933) Datasheet (External Link) |
| Vendor Page | Anti PHRF1 pAb (ATL-HPA062933) |