Protein Description: paired-like homeobox 2b
Gene Name: PHOX2B
Alternative Gene Name: NBPhox, Phox2b, PMX2B
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000012520: 100%, ENSRNOG00000051929: 100%
Entrez Gene ID: 8929
Uniprot ID: Q99453
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: PHOX2B
Alternative Gene Name: NBPhox, Phox2b, PMX2B
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000012520: 100%, ENSRNOG00000051929: 100%
Entrez Gene ID: 8929
Uniprot ID: Q99453
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | GPGQGWAPGPGPITSIPDSLGGPFASVLSSLQRPN |
| Documents & Links for Anti PHOX2B pAb (ATL-HPA074325) | |
| Datasheet | Anti PHOX2B pAb (ATL-HPA074325) Datasheet (External Link) |
| Vendor Page | Anti PHOX2B pAb (ATL-HPA074325) at Atlas |
| Documents & Links for Anti PHOX2B pAb (ATL-HPA074325) | |
| Datasheet | Anti PHOX2B pAb (ATL-HPA074325) Datasheet (External Link) |
| Vendor Page | Anti PHOX2B pAb (ATL-HPA074325) |