Protein Description: paired like homeobox 2a
Gene Name: PHOX2A
Alternative Gene Name: ARIX, CFEOM2, FEOM2, PMX2A
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000007946: 97%, ENSRNOG00000019706: 97%
Entrez Gene ID: 401
Uniprot ID: O14813
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: PHOX2A
Alternative Gene Name: ARIX, CFEOM2, FEOM2, PMX2A
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000007946: 97%, ENSRNOG00000019706: 97%
Entrez Gene ID: 401
Uniprot ID: O14813
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Gene Sequence | AAELLKAWQPAESGPGPFSGVLSSFHRKPGPALKTNLF |
Documents & Links for Anti PHOX2A pAb (ATL-HPA078004 w/enhanced validation) | |
Datasheet | Anti PHOX2A pAb (ATL-HPA078004 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti PHOX2A pAb (ATL-HPA078004 w/enhanced validation) at Atlas |
Documents & Links for Anti PHOX2A pAb (ATL-HPA078004 w/enhanced validation) | |
Datasheet | Anti PHOX2A pAb (ATL-HPA078004 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti PHOX2A pAb (ATL-HPA078004 w/enhanced validation) |