Protein Description: phosphoethanolamine/phosphocholine phosphatase
Gene Name: PHOSPHO1
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000050860: 90%, ENSRNOG00000005569: 90%
Entrez Gene ID: 162466
Uniprot ID: Q8TCT1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: PHOSPHO1
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000050860: 90%, ENSRNOG00000005569: 90%
Entrez Gene ID: 162466
Uniprot ID: Q8TCT1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Gene Sequence | RDLSAIYEAIPLSPGMSDLLQFVAKQGACFEVILISDANTFGVESSLRAAGHHSLFRRILSNPSGPDARGLLALRPF |
Documents & Links for Anti PHOSPHO1 pAb (ATL-HPA065025) | |
Datasheet | Anti PHOSPHO1 pAb (ATL-HPA065025) Datasheet (External Link) |
Vendor Page | Anti PHOSPHO1 pAb (ATL-HPA065025) at Atlas |
Documents & Links for Anti PHOSPHO1 pAb (ATL-HPA065025) | |
Datasheet | Anti PHOSPHO1 pAb (ATL-HPA065025) Datasheet (External Link) |
Vendor Page | Anti PHOSPHO1 pAb (ATL-HPA065025) |